Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 1
LigandBDBM25005
Substrate/CompetitorROCK1 Substrate Peptide
Meas. Tech.In Vitro Kinase Inhibition Assay
IC50 6±n/a nM
Citation Heerding DARhodes NLeber JDClark TJKeenan RMLafrance LVLi MSafonov IGTakata DTVenslavsky JWYamashita DSChoudhry AECopeland RALai ZSchaber MDTummino PJStrum SLWood ERDuckett DREberwein DKnick VBLansing TJMcConnell RTZhang SMinthorn EAConcha NOWarren GLKumar R Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase. J Med Chem 51:5663-79 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Ribosomal protein S6 kinase alpha 1
Name:Ribosomal protein S6 kinase alpha 1
Synonyms:90 kDa ribosomal protein S6 kinase 1 | MAP kinase-activated protein kinase 1a | MAPKAPK1A | RPS6KA1(Kin.Dom.1 - N-terminal) | RPS6KA1(Kin.Dom.2 - C-terminal) | RSK-1 | Ribosomal S6 Kinase 1 (RSK-1) | Ribosomal S6 kinase 1 | Ribosomal S6 kinase 1 (RSK1) | Ribosomal protein S6 kinase alpha-1 | Ribosomal protein S6 kinase alpha-1 (RSK1) | S6K-alpha 1 | p90-RSK 1 | p90S6K | pp90RSK1
Type:Serine/threonine-protein kinase
Mol. Mass.:82736.10
Organism:Homo sapiens (Human)
Description:n/a
Residue:735
Sequence:
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25005
ROCK1 Substrate Peptide
Name:ROCK1 Substrate Peptide
Synonyms:RSK1 Substrate Peptide
Type:Peptide
Mol. Mass.:1318.60
Organism:n/a
Description:n/a
Residue:11
Sequence:
AKRRRLSSLRA