| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 11 [205-593] |
|---|
| Ligand | BDBM25133 |
|---|
| Substrate/Competitor | BDBM13432 |
|---|
| Meas. Tech. | Inhibition of PTP Activity |
|---|
| pH | 6±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 5370±n/a nM |
|---|
| Citation |  Dawson, MI; Xia, Z; Jiang, T; Ye, M; Fontana, JA; Farhana, L; Patel, B; Xue, LP; Bhuiyan, M; Pellicciari, R; Macchiarulo, A; Nuti, R; Zhang, XK; Han, YH; Tautz, L; Hobbs, PD; Jong, L; Waleh, N; Chao, WR; Feng, GS; Pang, Y; Su, Y Adamantyl-substituted retinoid-derived molecules that interact with the orphan nuclear receptor small heterodimer partner: effects of replacing the 1-adamantyl or hydroxyl group on inhibition of cancer cell growth, induction of cancer cell apoptosis, and inhibition of SRC homology 2 domain-containi J Med Chem51:5650-62 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 11 [205-593] |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 11 [205-593] |
|---|
| Synonyms: | PTN11_HUMAN | PTP-1D | PTP-2C | PTP2C | PTPN11 | Protein-Tyrosine Phosphatase SHP-2 | SH-PTP3 | SHPTP2 | Shp2 |
|---|
| Type: | Protein phosphatase |
|---|
| Mol. Mass.: | 44924.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human recombinant GST-fusion SHP-2 (205-593). |
|---|
| Residue: | 389 |
|---|
| Sequence: | TLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYS
RKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPK
KSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMR
VRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLE
EVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQ
RSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLADQTSGDQSPL
PPCTPTPPCAEMREDSARVYENVGLMQQQ
|
|
|
|---|
| BDBM25133 |
|---|
| BDBM13432 |
|---|
| Name | BDBM25133 |
|---|
| Synonyms: | (2E)-3-{3-chloro-4-[3-(3-ethylpentan-3-yl)-4-hydroxyphenyl]phenyl}prop-2-enoic acid | 3-Cl-AHPC analogue, 12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25ClO3 |
|---|
| Mol. Mass. | 372.885 |
|---|
| SMILES | CCC(CC)(CC)c1cc(ccc1O)-c1ccc(\C=C\C(O)=O)cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
