Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCdc7 Kinase
LigandBDBM27362
Substrate/CompetitorMCM2
Meas. Tech.In Vitro Kinase Assay
pH7.9±n/a
Temperature298.15±n/a K
IC50 2±1 nM
Citation Menichincheri MBargiotti ABerthelsen JBertrand JABossi RCiavolella ACirla ACristiani CCroci VD'Alessio RFasolini MFiorentini FForte BIsacchi AMartina KMolinari AMontagnoli AOrsini POrzi FPesenti EPezzetta DPillan APoggesi IRoletto FScolaro ATatò MTibolla MValsasina BVarasi MVolpi DSantocanale CVanotti E First Cdc7 kinase inhibitors: pyrrolopyridinones as potent and orally active antitumor agents. 2. Lead discovery. J Med Chem 52:293-307 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Cdc7 Kinase
Name:Cdc7 Kinase
Synonyms:Cdc7/DBF4
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cdc7 Kinase
Synonyms:Cell division cycle 7-related protein kinase
Type:Serine/threonine-protein kinase
Mol. Mass.:57470.88
Organism:Homo sapiens (Human)
Description:n/a
Residue:517
Sequence:
FKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNV
MGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRD
VKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIP
LSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSS
ISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATD
KVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKA
SDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTS
DIQGHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNE
VPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:DBF4
Synonyms:Activator of S phase kinase | Chiffon homolog A | DBF4-type zinc finger-containing protein 1 | DBF4A | Protein DBF4 homolog A
Type:Regulatory subunit
Mol. Mass.:76869.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:674
Sequence:
MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
AFFSSPSTSTFTGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27362
MCM2
Name:MCM2
Synonyms:DNA replication licensing factor MCM2 | Minichromosome maintenance protein 2 homolog | Nuclear protein BM28
Type:Other Protein Type
Mol. Mass.:32619.37
Organism:Homo sapiens (Human)
Description:n/a
Residue:285
Sequence:
MASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDG
EELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLG
RMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMA
GPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLP
EAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: