| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Ligand | BDBM50255567 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1687437 |
|---|
| IC50 | 30±n/a nM |
|---|
| Citation |  Rahm, F; Viklund, J; Trésaugues, L; Ellermann, M; Giese, A; Ericsson, U; Forsblom, R; Ginman, T; Günther, J; Hallberg, K; Lindström, J; Persson, LB; Silvander, C; Talagas, A; Díaz-Sáez, L; Fedorov, O; Huber, KVM; Panagakou, I; Siejka, P; Gorjánácz, M; Bauser, M; Andersson, M Creation of a Novel Class of Potent and Selective MutT Homologue 1 (MTH1) Inhibitors Using Fragment-Based Screening and Structure-Based Drug Design. J Med Chem61:2533-2551 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Name: | Oxidized purine nucleoside triphosphate hydrolase |
|---|
| Synonyms: | 2-hydroxy-dATP diphosphatase | 3.6.1.- | 3.6.1.56 | 7,8-dihydro-8-oxoguanine triphosphatase | 8-oxo-dGTPase | 8ODP_HUMAN | MTH1 | Methylated purine nucleoside triphosphate hydrolase | MutT homolog 1 protein (MTH1) | NUDT1 | Nucleoside diphosphate-linked moiety X motif 1 | Nudix motif 1 | Oxidized purine nucleoside triphosphate hydrolase [42-197] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 22514.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P36639 |
|---|
| Residue: | 156 |
|---|
| Sequence: | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
|
|
|
|---|
| BDBM50255567 |
|---|
| n/a |
|---|
| Name | BDBM50255567 |
|---|
| Synonyms: | CHEMBL4066892 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H15N5 |
|---|
| Mol. Mass. | 265.3131 |
|---|
| SMILES | C1CC(N(C1)c1ccnc2[nH]ncc12)c1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
