| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50259954 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_1692054 |
|---|
| IC50 | >100000±n/a nM |
|---|
| Citation |  Butler, CR; Ogilvie, K; Martinez-Alsina, L; Barreiro, G; Beck, EM; Nolan, CE; Atchison, K; Benvenuti, E; Buzon, L; Doran, S; Gonzales, C; Helal, CJ; Hou, X; Hsu, MH; Johnson, EF; Lapham, K; Lanyon, L; Parris, K; O'Neill, BT; Riddell, D; Robshaw, A; Vajdos, F; Brodney, MA Aminomethyl-Derived Beta Secretase (BACE1) Inhibitors: Engaging Gly230 without an Anilide Functionality. J Med Chem60:386-402 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50259954 |
|---|
| n/a |
|---|
| Name | BDBM50259954 |
|---|
| Synonyms: | CHEMBL4094377 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H20F5N3S |
|---|
| Mol. Mass. | 381.407 |
|---|
| SMILES | CC(C)(NCc1cc(c(F)cc1F)[C@]1(C)CCSC(N)=N1)C(F)(F)F |r,c:20| |
|---|
| Structure | 
|
|---|
Search and Browse
