| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50469962 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1688928 (CHEMBL4039498) |
|---|
| IC50 | 145±n/a nM |
|---|
| Citation |  Famiglini, V; La Regina, G; Coluccia, A; Masci, D; Brancale, A; Badia, R; Riveira-Muñoz, E; Esté, JA; Crespan, E; Brambilla, A; Maga, G; Catalano, M; Limatola, C; Formica, FR; Cirilli, R; Novellino, E; Silvestri, R Chiral Indolylarylsulfone Non-Nucleoside Reverse Transcriptase Inhibitors as New Potent and Broad Spectrum Anti-HIV-1 Agents. J Med Chem60:6528-6547 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50469962 |
|---|
| n/a |
|---|
| Name | BDBM50469962 |
|---|
| Synonyms: | CHEMBL4078690 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H22ClN3O5S |
|---|
| Mol. Mass. | 499.967 |
|---|
| SMILES | Cc1cc(C)cc(c1)S(=O)(=O)c1c([nH]c2ccc(Cl)cc12)C(=O)NCC(=O)NCc1ccco1 |
|---|
| Structure | 
|
|---|
Search and Browse
