| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50123468 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_509666 (CHEMBL1004781) |
|---|
| IC50 | 10.0±n/a nM |
|---|
| Citation |  Di Santo, R; Costi, R; Roux, A; Miele, G; Crucitti, GC; Iacovo, A; Rosi, F; Lavecchia, A; Marinelli, L; Di Giovanni, C; Novellino, E; Palmisano, L; Andreotti, M; Amici, R; Galluzzo, CM; Nencioni, L; Palamara, AT; Pommier, Y; Marchand, C Novel quinolinonyl diketo acid derivatives as HIV-1 integrase inhibitors: design, synthesis, and biological activities. J Med Chem51:4744-50 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50123468 |
|---|
| n/a |
|---|
| Name | BDBM50123468 |
|---|
| Synonyms: | CHEMBL32865 | [3-Benzyl-5-(1,1-dioxo-1lambda 6 -isothiazolidin-2-ylmethyl)-phenyl]-(8-hydroxy-[1,6]naphthyridin-7-yl)-methanone | [3-Benzyl-5-(1,1-dioxo-1lambda*6*-isothiazolidin-2-ylmethyl)-phenyl]-(8-hydroxy-[1,6]naphthyridin-7-yl)-methanone | [3-benzyl-5-(1,1-dioxo-1lambda-6-isothiazolidin-2-ylmethyl)-phenyl]-(8-hydroxy-[1,6]naphthyridin-7-yl)-methanone |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H23N3O4S |
|---|
| Mol. Mass. | 473.544 |
|---|
| SMILES | Oc1c(ncc2cccnc12)C(=O)c1cc(CN2CCCS2(=O)=O)cc(Cc2ccccc2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
