Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50484026 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_755189 (CHEMBL1805968) |
---|
Ki | 20±n/a nM |
---|
Citation | Su, DS; Lim, JJ; Tinney, E; Tucker, TJ; Saggar, S; Sisko, JT; Wan, BL; Young, MB; Anderson, KD; Rudd, D; Munshi, V; Bahnck, C; Felock, PJ; Lu, M; Lai, MT; Touch, S; Moyer, G; Distefano, DJ; Flynn, JA; Liang, Y; Sanchez, R; Perlow-Poehnelt, R; Miller, M; Vacca, JP; Williams, TM; Anthony, NJ Biaryl ethers as potent allosteric inhibitors of reverse transcriptase and its key mutant viruses: aryl substituted pyrazole as a surrogate for the pyrazolopyridine motif. Bioorg Med Chem Lett20:4328-32 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50484026 |
---|
n/a |
---|
Name | BDBM50484026 |
Synonyms: | CHEMBL1801225 |
Type | Small organic molecule |
Emp. Form. | C23H14Cl2N2O3 |
Mol. Mass. | 437.275 |
SMILES | Clc1cc(Oc2cc(OCc3cc(on3)-c3ccccc3)ccc2Cl)cc(c1)C#N |
Structure |
|