Reaction Details |
| Report a problem with these data |
Target | Oxidized purine nucleoside triphosphate hydrolase |
---|
Ligand | BDBM50152124 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1844828 (CHEMBL4345255) |
---|
IC50 | 26±n/a nM |
---|
Citation | Farand, J; Kropf, JE; Blomgren, P; Xu, J; Schmitt, AC; Newby, ZE; Wang, T; Murakami, E; Barauskas, O; Sudhamsu, J; Feng, JY; Niedziela-Majka, A; Schultz, BE; Schwartz, K; Viatchenko-Karpinski, S; Kornyeyev, D; Kashishian, A; Fan, P; Chen, X; Lansdon, EB; Ports, MO; Currie, KS; Watkins, WJ; Notte, GT Discovery of Potent and Selective MTH1 Inhibitors for Oncology: Enabling Rapid Target (In)Validation. ACS Med Chem Lett11:358-364 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Oxidized purine nucleoside triphosphate hydrolase |
---|
Name: | Oxidized purine nucleoside triphosphate hydrolase |
Synonyms: | 2-hydroxy-dATP diphosphatase | 3.6.1.- | 3.6.1.56 | 7,8-dihydro-8-oxoguanine triphosphatase | 8-oxo-dGTPase | 8ODP_HUMAN | MTH1 | Methylated purine nucleoside triphosphate hydrolase | MutT homolog 1 protein (MTH1) | NUDT1 | Nucleoside diphosphate-linked moiety X motif 1 | Nudix motif 1 | Oxidized purine nucleoside triphosphate hydrolase [42-197] |
Type: | Protein |
Mol. Mass.: | 22514.81 |
Organism: | Homo sapiens (Human) |
Description: | P36639 |
Residue: | 156 |
Sequence: | MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLT
VDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDD
SYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV
|
|
|
BDBM50152124 |
---|
n/a |
---|
Name | BDBM50152124 |
Synonyms: | CHEMBL3782004 |
Type | Small organic molecule |
Emp. Form. | C13H12Cl2N4 |
Mol. Mass. | 295.167 |
SMILES | Nc1nc(NC2CC2)cc(n1)-c1cccc(Cl)c1Cl |
Structure |
|