Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50106105
Substrate/Competitorn/a
Meas. Tech.ChEBML_154542
EC50 19±n/a nM
Citation Liu KGLambert MHLeesnitzer LMOliver WOtt RJPlunket KDStuart LWBrown PJWillson TMSternbach DD Identification of a series of PPAR gamma/delta dual agonists via solid-phase parallel synthesis. Bioorg Med Chem Lett 11:2959-62 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50106105
n/a
NameBDBM50106105
Synonyms:2-[3-(3-{(2,4-Bis-trifluoromethyl-benzyl)-[2-(4-trifluoromethyl-phenyl)-acetyl]-amino}-propyl)-phenoxy]-2-methyl-propionic acid | CHEMBL102004
TypeSmall organic molecule
Emp. Form.C31H28F9NO4
Mol. Mass.649.5439
SMILESCC(C)(Oc1cccc(CCCN(Cc2ccc(cc2C(F)(F)F)C(F)(F)F)C(=O)Cc2ccc(cc2)C(F)(F)F)c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: