| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pteridine reductase 1 |
|---|
| Ligand | BDBM50551178 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2030456 (CHEMBL4684614) |
|---|
| Ki | 19200±n/a nM |
|---|
| Citation |  Linciano, P; Cullia, G; Borsari, C; Santucci, M; Ferrari, S; Witt, G; Gul, S; Kuzikov, M; Ellinger, B; Santarém, N; Cordeiro da Silva, A; Conti, P; Bolognesi, ML; Roberti, M; Prati, F; Bartoccini, F; Retini, M; Piersanti, G; Cavalli, A; Goldoni, L; Bertozzi, SM; Bertozzi, F; Brambilla, E; Rizzo, V; Piomelli, D; Pinto, A; Bandiera, T; Costi, MP Identification of a 2,4-diaminopyrimidine scaffold targeting Trypanosoma brucei pteridine reductase 1 from the LIBRA compound library screening campaign. Eur J Med Chem189:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Pteridine reductase 1 |
|---|
| Name: | Pteridine reductase 1 |
|---|
| Synonyms: | HMTXR | PTR1 | PTR1_LEIMA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30459.34 |
|---|
| Organism: | Leishmania major |
|---|
| Description: | ChEMBL_1470027 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MTAPTVPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAI
TVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLR
NDEDGHEPCVGDREAMETATADLFGSNAIAPYFLIKAFAHRFAGTPAKHRGTNYSIINMV
DAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEG
HRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
|
|
|
|---|
| BDBM50551178 |
|---|
| n/a |
|---|
| Name | BDBM50551178 |
|---|
| Synonyms: | CHEMBL4785591 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C48H64N4O2 |
|---|
| Mol. Mass. | 729.0474 |
|---|
| SMILES | O=C1CCCCCNCc2ccc(cc2)-c2ccc(CNCCCCCC(=O)N(Cc3ccccc3)CCCCCCCCN1Cc1ccccc1)cc2 |
|---|
| Structure | 
|
|---|
Search and Browse
