| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50116914 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79956 |
|---|
| IC50 | 0.150000±n/a nM |
|---|
| Citation |  Cheng, Y; Zhang, F; Rano, TA; Lu, Z; Schleif, WA; Gabryelski, L; Olsen, DB; Stahlhut, M; Rutkowski, CA; Lin, JH; Jin, L; Emini, EA; Chapman, KT; Tata, JR Indinavir analogues with blocked metabolism sites as HIV protease inhibitors with improved pharmacological profiles and high potency against PI-resistant viral strains. Bioorg Med Chem Lett12:2419-22 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50116914 |
|---|
| n/a |
|---|
| Name | BDBM50116914 |
|---|
| Synonyms: | (S)-4-(1-Furo[3,2-c]pyridin-2-yl-1-methyl-ethyl)-1-[(2S,4R)-2-hydroxy-4-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-piperazine-2-carboxylic acid tert-butylamide | CHEMBL78876 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H51N5O5 |
|---|
| Mol. Mass. | 681.8634 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1CN(CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)C(C)(C)c1cc2cnccc2o1 |
|---|
| Structure | 
|
|---|
Search and Browse
