| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 1 |
|---|
| Ligand | BDBM50150559 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_306397 (CHEMBL828738) |
|---|
| IC50 | 3100±n/a nM |
|---|
| Citation |  Weidner-Wells, MA; Henninger, TC; Fraga-Spano, SA; Boggs, CM; Matheis, M; Ritchie, DM; Argentieri, DC; Wachter, MP; Hlasta, DJ Synthesis and structure-activity relationships of 3,5-diarylisoxazoles and 3,5-diaryl-1,2,4-oxadiazoles, novel classes of small molecule interleukin-8 (IL-8) receptor antagonists. Bioorg Med Chem Lett14:4307-11 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 1 |
|---|
| Name: | C-X-C chemokine receptor type 1 |
|---|
| Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39803.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25024 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
|---|
| BDBM50150559 |
|---|
| n/a |
|---|
| Name | BDBM50150559 |
|---|
| Synonyms: | CHEMBL182361 | {4-[5-(4-Fluoro-phenyl)-isoxazol-3-yl]-phenoxymethyl}-dimethyl-amine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H17FN2O2 |
|---|
| Mol. Mass. | 312.3382 |
|---|
| SMILES | CN(C)COc1ccc(cc1)-c1cc(on1)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
