Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50151157 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303373 (CHEMBL839691) |
---|
Ki | 1370±n/a nM |
---|
Citation | Shoda, M; Harada, T; Kogami, Y; Tsujita, R; Akashi, H; Kouji, H; Stahura, FL; Xue, L; Bajorath, J Identification of structurally diverse growth hormone secretagogue agonists by virtual screening and structure-activity relationship analysis of 2-formylaminoacetamide derivatives. J Med Chem47:4286-90 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50151157 |
---|
n/a |
---|
Name | BDBM50151157 |
Synonyms: | 5-Phenyl-1H-pyrrole-2-carboxylic acid [cyclohexylcarbamoyl-(4-fluoro-phenyl)-methyl]-(2-diethylamino-ethyl)-amide | CHEMBL188582 |
Type | Small organic molecule |
Emp. Form. | C31H39FN4O2 |
Mol. Mass. | 518.6654 |
SMILES | CCN(CC)CCN(C(C(=O)NC1CCCCC1)c1ccc(F)cc1)C(=O)c1ccc([nH]1)-c1ccccc1 |
Structure |
|