Reaction Details |
| Report a problem with these data |
Target | Gonadotropin-releasing hormone receptor |
---|
Ligand | BDBM50152714 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_303704 (CHEMBL829039) |
---|
Ki | 2±n/a nM |
---|
Citation | Rowbottom, MW; Tucci, FC; Connors, PJ; Gross, TD; Zhu, YF; Guo, Z; Moorjani, M; Acevedo, O; Carter, L; Sullivan, SK; Xie, Q; Fisher, A; Struthers, RS; Saunders, J; Chen, C Synthesis and structure-activity relationships of uracil derived human GnRH receptor antagonists: (R)-3-[2-(2-amino)phenethyl]-1-(2,6-difluorobenzyl)-6-methyluracils containing a substituted thiophene or thiazole at C-5. Bioorg Med Chem Lett14:4967-73 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gonadotropin-releasing hormone receptor |
---|
Name: | Gonadotropin-releasing hormone receptor |
Synonyms: | GNRHR | GNRHR_HUMAN | GRHR | GnRH receptor | GnRH-R | Gonadotropin releasing hormone 1 (GnRHR1) | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH) |
Type: | Enzyme |
Mol. Mass.: | 37749.45 |
Organism: | Homo sapiens (Human) |
Description: | P30968 |
Residue: | 328 |
Sequence: | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
BDBM50152714 |
---|
n/a |
---|
Name | BDBM50152714 |
Synonyms: | (R)-1-(2,6-difluorobenzyl)-3-(2-amino-2-phenylethyl)-5-(5-chlorothiophen-2-yl)-6-methylpyrimidine-2,4(1H,3H)-dione | 3-((R)-2-Amino-2-phenyl-ethyl)-5-(5-chloro-thiophen-2-yl)-1-(2,6-difluoro-benzyl)-6-methyl-1H-pyrimidine-2,4-dione | CHEMBL363759 |
Type | Small organic molecule |
Emp. Form. | C24H20ClF2N3O2S |
Mol. Mass. | 487.949 |
SMILES | Cc1c(-c2ccc(Cl)s2)c(=O)n(C[C@H](N)c2ccccc2)c(=O)n1Cc1c(F)cccc1F |r| |
Structure |
|