| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptophan 2,3-dioxygenase |
|---|
| Ligand | BDBM50584072 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2158975 (CHEMBL5043725) |
|---|
| IC50 | 1251±n/a nM |
|---|
| Citation |  Yeh, TK; Song, JS; Chang, PW; Yu, JC; Chang, CH; Liao, FY; Tien, YW; Kuppusamy, R; Li, AS; Chen, CH; Chen, CW; Lin, LM; Chang, HH; Huang, CH; Yao, JY; Wu, MH; Peng, YH; Hsueh, CC; Hsiao, WC; Chen, PH; Lin, CY; Hsieh, SH; Shih, C; Hung, MS; Wu, SY; Kuo, CC; Ueng, SH Discovery and development of a novel N-(3-bromophenyl)-{[(phenylcarbamoyl)amino]methyl}-N-hydroxythiophene-2-carboximidamide indoleamine 2,3-dioxygenase inhibitor using knowledge-based drug design. Eur J Med Chem229:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tryptophan 2,3-dioxygenase |
|---|
| Name: | Tryptophan 2,3-dioxygenase |
|---|
| Synonyms: | T23O_HUMAN | TDO | TDO2 | TO | TRPO | Tryptamin 2,3-dioxygenase | Tryptophan oxygenase | Tryptophan pyrrolase | Tryptophanase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 47874.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_825691 |
|---|
| Residue: | 406 |
|---|
| Sequence: | MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
|
|
|
|---|
| BDBM50584072 |
|---|
| n/a |
|---|
| Name | BDBM50584072 |
|---|
| Synonyms: | CHEMBL5071322 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H9BrClN3O |
|---|
| Mol. Mass. | 326.576 |
|---|
| SMILES | O\N=C(/Nc1cccc(Br)c1)c1ccc(Cl)nc1 |
|---|
| Structure | 
|
|---|
Search and Browse
