Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50587109 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2170916 (CHEMBL5056050) |
---|
IC50 | 73±n/a nM |
---|
Citation | Zhang, H; Hsu, HC; Kahne, SC; Hara, R; Zhan, W; Jiang, X; Burns-Huang, K; Ouellette, T; Imaeda, T; Okamoto, R; Kawasaki, M; Michino, M; Wong, TT; Toita, A; Yukawa, T; Moraca, F; Vendome, J; Saha, P; Sato, K; Aso, K; Ginn, J; Meinke, PT; Foley, M; Nathan, CF; Darwin, KH; Li, H; Lin, G Macrocyclic Peptides that Selectively Inhibit the J Med Chem64:6262-6272 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50587109 |
---|
n/a |
---|
Name | BDBM50587109 |
Synonyms: | CHEMBL5079787 |
Type | Small organic molecule |
Emp. Form. | C33H41FN4O5 |
Mol. Mass. | 592.7008 |
SMILES | Fc1ccccc1CNC(=O)[C@@H]1CCCCOc2cccc(CCC(=O)N[C@@H](CC(=O)N3CCC[C@@H]3C3CC3)C(=O)N1)c2 |r| |
Structure |
|