Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50158340 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_430296 (CHEMBL913922) |
---|
IC50 | 640±n/a nM |
---|
Citation | Hale, JJ; Lynch, CL; Neway, W; Mills, SG; Hajdu, R; Keohane, CA; Rosenbach, MJ; Milligan, JA; Shei, GJ; Parent, SA; Chrebet, G; Bergstrom, J; Card, D; Ferrer, M; Hodder, P; Strulovici, B; Rosen, H; Mandala, S A rational utilization of high-throughput screening affords selective, orally bioavailable 1-benzyl-3-carboxyazetidine sphingosine-1-phosphate-1 receptor agonists. J Med Chem47:6662-5 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50158340 |
---|
n/a |
---|
Name | BDBM50158340 |
Synonyms: | 1-(3,5-dichloro-4-((4-phenyl-5-(trifluoromethyl)thiophen-2-yl)methoxy)benzyl)azetidine-3-carboxylic acid | CHEMBL426191 |
Type | Small organic molecule |
Emp. Form. | C23H18Cl2F3NO3S |
Mol. Mass. | 516.36 |
SMILES | OC(=O)C1CN(Cc2cc(Cl)c(OCc3cc(c(s3)C(F)(F)F)-c3ccccc3)c(Cl)c2)C1 |
Structure |
|