| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glucose-induced degradation protein 4 homolog |
|---|
| Ligand | BDBM50589795 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2194344 (CHEMBL5106704) |
|---|
| IC50 | 149100±n/a nM |
|---|
| Citation |  Chana, CK; Maisonneuve, P; Posternak, G; Grinberg, NGA; Poirson, J; Ona, SM; Ceccarelli, DF; Mader, P; St-Cyr, DJ; Pau, V; Kurinov, I; Tang, X; Deng, D; Cui, W; Su, W; Kuai, L; Soll, R; Tyers, M; Röst, HL; Batey, RA; Taipale, M; Gingras, AC; Sicheri, F Discovery and Structural Characterization of Small Molecule Binders of the Human CTLH E3 Ligase Subunit GID4. J Med Chem65:12725-12746 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glucose-induced degradation protein 4 homolog |
|---|
| Name: | Glucose-induced degradation protein 4 homolog |
|---|
| Synonyms: | C17orf39 | GID4 | GID4_HUMAN | VID24 | Vacuolar import and degradation protein 24 homolog |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33527.13 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_120713 |
|---|
| Residue: | 300 |
|---|
| Sequence: | MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATL
LGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATS
LLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEII
SKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL
VPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
|
|
|
|---|
| BDBM50589795 |
|---|
| n/a |
|---|
| Name | BDBM50589795 |
|---|
| Synonyms: | CHEMBL5195783 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H12FNS |
|---|
| Mol. Mass. | 233.304 |
|---|
| SMILES | Fc1ccccc1C1NCCc2sccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
