Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTryptase beta-1/beta-2
LigandBDBM50187176
Substrate/Competitorn/a
Meas. Tech.ChEMBL_387229
Ki 1.9±n/a nM
Citation Lee CSLiu WSprengeler PASomoza JRJanc JWSperandio DSpencer JRGreen MJMcGrath ME Design of novel, potent, and selective human beta-tryptase inhibitors based on alpha-keto-[1,2,4]-oxadiazoles. Bioorg Med Chem Lett 16:4036-40 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tryptase beta-1/beta-2
Name:Tryptase beta-1/beta-2
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 387229
Components:This complex has 2 components.
Component 1
Name:Tryptase
Synonyms:Tryptase II | Tryptase beta-1 | Tryptase beta-2 | Tryptase-2
Type:PROTEIN
Mol. Mass.:30518.79
Organism:Homo sapiens (Human)
Description:ChEMBL_210702
Residue:275
Sequence:
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Tryptase
Synonyms:Tryptase II | Tryptase beta-1 | Tryptase beta-2 | Tryptase-2
Type:PROTEIN
Mol. Mass.:30518.79
Organism:Homo sapiens (Human)
Description:ChEMBL_210702
Residue:275
Sequence:
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50187176
n/a
NameBDBM50187176
Synonyms:(S)-ethyl 1-(5-(4-((3-chlorophenethyl)carbamoyl)benzyl)-1,2,4-oxadiazol-3-yl)-6-amino-1-oxohexan-2-ylcarbamate | CHEMBL209395
TypeSmall organic molecule
Emp. Form.C27H32ClN5O5
Mol. Mass.542.026
SMILESCCOC(=O)N[C@@H](CCCCN)C(=O)c1noc(Cc2ccc(cc2)C(=O)NCCc2cccc(Cl)c2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: