Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50200402
Substrate/Competitorn/a
Meas. Tech.ChEMBL_453682
IC50 1390±n/a nM
Citation Cantin LDLiang SOgutu HIwuagwu CIBoakye KBullock WHBurns MClark RClaus TdelaCruz FEDaly MEhrgott FJJohnson JSKeiper CLivingston JNSchoenleber RWShapiro JTown CYang LTsutsumi MMa X Indanylacetic acid derivatives carrying aryl-pyridyl and aryl-pyrimidinyl tail groups--new classes of PPAR gamma/delta and PPAR alpha/gamma/delta agonists. Bioorg Med Chem Lett 17:1056-61 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50200402
n/a
NameBDBM50200402
Synonyms:2-((S)-5-(3-(5-(5-acetyl-4-methylthiazol-2-yl)pyridin-2-yloxy)propoxy)-2,3-dihydro-1H-inden-1-yl)acetic acid | CHEMBL241063
TypeSmall organic molecule
Emp. Form.C25H26N2O5S
Mol. Mass.466.549
SMILESCC(=O)c1sc(nc1C)-c1ccc(OCCCOc2ccc3[C@H](CC(O)=O)CCc3c2)nc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: