Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2C
LigandBDBM50205858
Substrate/Competitorn/a
Meas. Tech.ChEMBL_428466
Ki 36±n/a nM
Citation Wacker DAVarnes JGMalmstrom SECao XHung CPUng TWu GZhang GZuvich EThomas MAKeim WJCullen MJRohrbach KWQu QNarayanan RRossi KJanovitz ELehman-McKeeman LMalley MFDevenny JPelleymounter MAMiller KJRobl JA Discovery of (R)-9-ethyl-1,3,4,10b-tetrahydro-7-trifluoromethylpyrazino[2,1-a]isoindol- 6(2H)-one, a selective, orally active agonist of the 5-HT(2C) receptor. J Med Chem 50:1365-79 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2C
Name:Serotonin receptor (2b and 2c)
Synonyms:5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2A (5-HT2A) | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:51836.79
Organism:Homo sapiens (Human)
Description:P28335
Residue:458
Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205858
n/a
NameBDBM50205858
Synonyms:(R)-9-ethyl-8-methoxy-1,3,4,10b-tetrahydropyrazino[2,1-a]-isoindol-6(2H)-one | CHEMBL374436
TypeSmall organic molecule
Emp. Form.C14H18N2O2
Mol. Mass.246.3049
SMILESCCc1cc2[C@@H]3CNCCN3C(=O)c2cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: