| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM29995 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_556070 (CHEMBL953423) |
|---|
| IC50 | >1000±n/a nM |
|---|
| Citation |  Okamoto, O; Kobayashi, K; Kawamoto, H; Ito, S; Yoshizumi, T; Yamamoto, I; Hashimoto, M; Shimizu, A; Takahashi, H; Ishii, Y; Ozaki, S; Ohta, H Novel ORL1-selective antagonists with oral bioavailability and brain penetrability. Bioorg Med Chem Lett18:3282-5 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM29995 |
|---|
| n/a |
|---|
| Name | BDBM29995 |
|---|
| Synonyms: | CHEMBL494350 | benzimidazole-based antagonist, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H27ClN4OS |
|---|
| Mol. Mass. | 382.951 |
|---|
| SMILES | C[C@@H]1CN(CCO)CCN1c1cc2[nH]c(SC(C)(C)C)nc2cc1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
