Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM29995 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_556073 (CHEMBL953426) |
---|
IC50 | 1200±n/a nM |
---|
Citation | Okamoto, O; Kobayashi, K; Kawamoto, H; Ito, S; Yoshizumi, T; Yamamoto, I; Hashimoto, M; Shimizu, A; Takahashi, H; Ishii, Y; Ozaki, S; Ohta, H Novel ORL1-selective antagonists with oral bioavailability and brain penetrability. Bioorg Med Chem Lett18:3282-5 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM29995 |
---|
n/a |
---|
Name | BDBM29995 |
Synonyms: | CHEMBL494350 | benzimidazole-based antagonist, 1 |
Type | Small organic molecule |
Emp. Form. | C18H27ClN4OS |
Mol. Mass. | 382.951 |
SMILES | C[C@@H]1CN(CCO)CCN1c1cc2[nH]c(SC(C)(C)C)nc2cc1Cl |r| |
Structure |
|