| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50243887 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_491468 (CHEMBL949524) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Yoshizumi, T; Takahashi, H; Miyazoe, H; Sugimoto, Y; Tsujita, T; Kato, T; Ito, H; Kawamoto, H; Hirayama, M; Ichikawa, D; Azuma-Kanoh, T; Ozaki, S; Shibata, Y; Tani, T; Chiba, M; Ishii, Y; Okuda, S; Tadano, K; Fukuroda, T; Okamoto, O; Ohta, H A novel class of cycloalkano[b]pyridines as potent and orally active opioid receptor-like 1 antagonists with minimal binding affinity to the hERG K+ channel. J Med Chem51:4021-9 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50243887 |
|---|
| n/a |
|---|
| Name | BDBM50243887 |
|---|
| Synonyms: | (-)-(3R,4R)-4-(2-Chloro-4-fluorophenyl)-3-hydroxy-1-{[(6R,8S)-8-hydroxy-5,6,7,8-tetrahydroquinolin-6-yl]methyl}piperidinium Chloride | (6R,8S)-6-(((3R,4R)-4-(2-chloro-4-fluorophenyl)-3-hydroxypiperidin-1-yl)methyl)-5,6,7,8-tetrahydroquinolin-8-ol | CHEMBL487458 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24ClFN2O2 |
|---|
| Mol. Mass. | 390.879 |
|---|
| SMILES | O[C@H]1CN(C[C@H]2C[C@H](O)c3ncccc3C2)CC[C@@H]1c1ccc(F)cc1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
