Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelial lipase
LigandBDBM50254434
Substrate/Competitorn/a
Meas. Tech.ChEMBL_559992
IC50 250±n/a nM
Citation Goodman KBBury MJCheung MCichy-Knight MADowdell SEDunn AKLee DLieby JAMoore MLScherzer DASha DSuarez DPMurphy DJHarpel MRManas ESMcNulty DEAnnan RSMatico RESchwartz BKTrill JJSweitzer TDWang DYKeller PMKrawiec JAJaye MC Discovery of potent, selective sulfonylfuran urea endothelial lipase inhibitors. Bioorg Med Chem Lett 19:27-30 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endothelial lipase
Name:Endothelial lipase
Synonyms:EDL | EL | Endothelial cell-derived lipase | LIPG
Type:Protein
Mol. Mass.:56805.62
Organism:Homo sapiens (Human)
Description:Q9Y5X9
Residue:500
Sequence:
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50254434
n/a
NameBDBM50254434
Synonyms:5-Methyl-4-(3-phenyl-ureido)-furan-2-sulfonic acid (2-methoxy-ethyl)-methyl-amide | CHEMBL468281
TypeSmall organic molecule
Emp. Form.C16H21N3O5S
Mol. Mass.367.42
SMILESCOCCN(C)S(=O)(=O)c1cc(NC(=O)Nc2ccccc2)c(C)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: