Reaction Details |
| Report a problem with these data |
Target | Substance-P receptor |
---|
Ligand | BDBM50290865 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_143042 |
---|
IC50 | 0.150000±n/a nM |
---|
Citation | Swain, CJ; Williams, BJ; Baker, R; Cascieri, MA; Chicchi, G; Forrest, M; Herbert, R; Keown, L; Ladduwahetty, T; Luell, S; MacIntyre, DE; Metzger, J; Morton, S; Owens, AP; Sadowski, S; Watt, AP 3-Benzyloxy-2-phenylpiperidine NK1 antagonists: the influence of alpha methyl substitution Bioorg Med Chem Lett7:2959-2962 (1997) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Substance-P receptor |
---|
Name: | Substance-P receptor |
Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | NK1R_RAT | Neurokinin 1 receptor | Neurokinin NK1 | SPR | Substance-P receptor | Tac1r | Tachykinin receptor 1 | Tacr1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46371.54 |
Organism: | Rattus norvegicus (rat) |
Description: | Competition binding assays were carried out using membrane preparations from transfected CHO cells that constitutively expressed the rat NK1 receptor. |
Residue: | 407 |
Sequence: | MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAH
KRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVIFVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNRTYEKAYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHVFFLLPYINPDLYLKKFIQQVYLASMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQSSVYKVSRLETTIST
VVGAHEEEPEEGPKATPSSLDLTSNGSSRSNSKTMTESSSFYSNMLA
|
|
|
BDBM50290865 |
---|
n/a |
---|
Name | BDBM50290865 |
Synonyms: | 3-[1-(3,5-Bis-trifluoromethyl-phenyl)-ethoxy]-2-phenyl-piperidine | CHEMBL102032 |
Type | Small organic molecule |
Emp. Form. | C21H21F6NO |
Mol. Mass. | 417.388 |
SMILES | C[C@@H](O[C@H]1CCCN[C@H]1c1ccccc1)c1cc(cc(c1)C(F)(F)F)C(F)(F)F |
Structure |
|