Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50227631 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_597590 (CHEMBL1050553) |
---|
IC50 | 1±n/a nM |
---|
Citation | Giroux, A; Boulet, L; Brideau, C; Chau, A; Claveau, D; Côté, B; Ethier, D; Frenette, R; Gagnon, M; Guay, J; Guiral, S; Mancini, J; Martins, E; Massé, F; Méthot, N; Riendeau, D; Rubin, J; Xu, D; Yu, H; Ducharme, Y; Friesen, RW Discovery of disubstituted phenanthrene imidazoles as potent, selective and orally active mPGES-1 inhibitors. Bioorg Med Chem Lett19:5837-41 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50227631 |
---|
n/a |
---|
Name | BDBM50227631 |
Synonyms: | 2-(6-chloro-1H-phenanthro[9,10-d]imidazol-2-yl)isophthalonitrile | CHEMBL412099 |
Type | Small organic molecule |
Emp. Form. | C23H11ClN4 |
Mol. Mass. | 378.813 |
SMILES | Clc1ccc2c3[nH]c(nc3c3ccccc3c2c1)-c1c(cccc1C#N)C#N |
Structure |
|