| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 3A |
|---|
| Ligand | BDBM50319676 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_634700 (CHEMBL1118785) |
|---|
| IC50 | 5700±n/a nM |
|---|
| Citation |  Ghiron, C; Haydar, SN; Aschmies, S; Bothmann, H; Castaldo, C; Cocconcelli, G; Comery, TA; Di, L; Dunlop, J; Lock, T; Kramer, A; Kowal, D; Jow, F; Grauer, S; Harrison, B; La Rosa, S; Maccari, L; Marquis, KL; Micco, I; Nencini, A; Quinn, J; Robichaud, AJ; Roncarati, R; Scali, C; Terstappen, GC; Turlizzi, E; Valacchi, M; Varrone, M; Zanaletti, R; Zanelli, U Novel alpha-7 nicotinic acetylcholine receptor agonists containing a urea moiety: identification and characterization of the potent, selective, and orally efficacious agonist 1-[6-(4-fluorophenyl)pyridin-3-yl]-3-(4-piperidin-1-ylbutyl) urea (SEN34625/WYE-103914). J Med Chem53:4379-89 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 3A |
|---|
| Name: | 5-hydroxytryptamine receptor 3A |
|---|
| Synonyms: | 5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | 5HT3A_HUMAN | 5HT3R | HTR3 | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 55283.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46098 |
|---|
| Residue: | 478 |
|---|
| Sequence: | MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
|
|
|
|---|
| BDBM50319676 |
|---|
| n/a |
|---|
| Name | BDBM50319676 |
|---|
| Synonyms: | 1-(2'-fluorobiphenyl-4-yl)-3-(4-(piperidin-1-yl)butyl)urea | CHEMBL1085379 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28FN3O |
|---|
| Mol. Mass. | 369.4756 |
|---|
| SMILES | Fc1ccccc1-c1ccc(NC(=O)NCCCCN2CCCCC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
