Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalonyl-CoA decarboxylase
LigandBDBM50328235
Substrate/Competitorn/a
Meas. Tech.ChEMBL_665404
IC50 0.9±n/a nM
Citation Tang HYan YFeng Zde Jesus RKYang LLevorse DAOwens KAAkiyama TEBergeron RCastriota GADoebber TWEllsworth KPLassman MELi CWu MSZhang BBChapman KTMills SGBerger JPPasternak A Design and synthesis of a new class of malonyl-CoA decarboxylase inhibitors with anti-obesity and anti-diabetic activities. Bioorg Med Chem Lett 20:6088-92 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Malonyl-CoA decarboxylase
Name:Malonyl-CoA decarboxylase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55018.37
Organism:Homo sapiens (Human)
Description:ChEMBL_665404
Residue:493
Sequence:
MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSEC
KEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQV
LSLVAQFQKNSKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50328235
n/a
NameBDBM50328235
Synonyms:3-(1-(5-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)thiazol-2-yl)piperidin-4-yl)benzoic acid | CHEMBL1257549
TypeSmall organic molecule
Emp. Form.C18H16F6N2O3S
Mol. Mass.454.387
SMILESOC(=O)c1cccc(c1)C1CCN(CC1)c1ncc(s1)C(O)(C(F)(F)F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: