Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50337642 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_728758 (CHEMBL1686171) |
---|
IC50 | 1300±n/a nM |
---|
Citation | Chiasson, JF; Boulet, L; Brideau, C; Chau, A; Claveau, D; Côté, B; Ethier, D; Giroux, A; Guay, J; Guiral, S; Mancini, J; Massé, F; Méthot, N; Riendeau, D; Roy, P; Rubin, J; Xu, D; Yu, H; Ducharme, Y; Friesen, RW Trisubstituted ureas as potent and selective mPGES-1 inhibitors. Bioorg Med Chem Lett21:1488-92 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | MGST1L1 | MPGES1 | PGES | PIG12 | PTGES | PTGES_HUMAN | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50337642 |
---|
n/a |
---|
Name | BDBM50337642 |
Synonyms: | 1-benzyl-3-isopropyl-1-(3-((3-methoxyphenyl)ethynyl)benzyl)urea | CHEMBL1683199 |
Type | Small organic molecule |
Emp. Form. | C27H28N2O2 |
Mol. Mass. | 412.5234 |
SMILES | COc1cccc(c1)C#Cc1cccc(CN(Cc2ccccc2)C(=O)NC(C)C)c1 |
Structure |
|