| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RAC-alpha serine/threonine-protein kinase |
|---|
| Ligand | BDBM50348880 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_758494 (CHEMBL1811572) |
|---|
| IC50 | >25000±n/a nM |
|---|
| Citation |  Dyckman, AJ; Li, T; Pitt, S; Zhang, R; Shen, DR; McIntyre, KW; Gillooly, KM; Shuster, DJ; Doweyko, AM; Sack, JS; Kish, K; Kiefer, SE; Newitt, JA; Zhang, H; Marathe, PH; McKinnon, M; Barrish, JC; Dodd, JH; Schieven, GL; Leftheris, K Discovery of pyrrolo[2,1-f][1,2,4]triazine C6-ketones as potent, orally active p38a MAP kinase inhibitors. Bioorg Med Chem Lett21:4633-7 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RAC-alpha serine/threonine-protein kinase |
|---|
| Name: | RAC-alpha serine/threonine-protein kinase |
|---|
| Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 55681.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31749 |
|---|
| Residue: | 480 |
|---|
| Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
|---|
| BDBM50348880 |
|---|
| n/a |
|---|
| Name | BDBM50348880 |
|---|
| Synonyms: | CHEMBL1807446 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23N5O2 |
|---|
| Mol. Mass. | 425.4824 |
|---|
| SMILES | Cc1c(cn2ncnc(Nc3cc(ccc3C)C(=O)NC3CC3)c12)C(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
