| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50090231 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_213072 |
|---|
| Ki | 260000±n/a nM |
|---|
| Citation |  Baettig, U; Brown, L; Brundish, D; Dell, C; Furzer, A; Garman, S; Janus, D; Kane, PD; Smith, G; Walker, CV; Cockcroft, X; Ambler, J; Mitchelson, A; Talbot, MD; Tweed, M; Wills, N The design and synthesis of thrombin inhibitors: analogues of MD805 containing non-polar surrogates for arginine at the P1 position. Bioorg Med Chem Lett10:1563-6 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50090231 |
|---|
| n/a |
|---|
| Name | BDBM50090231 |
|---|
| Synonyms: | CHEMBL39375 | MD805 Analogue |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36N4O3S2 |
|---|
| Mol. Mass. | 540.74 |
|---|
| SMILES | CCC1CCN(CC1)C(=O)C(Cc1nc2ccccc2s1)NS(=O)(=O)c1cccc2CC(C)(C)CNc12 |
|---|
| Structure | 
|
|---|
Search and Browse
