| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50091594 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159321 (CHEMBL769374) |
|---|
| IC50 | 0.27±n/a nM |
|---|
| Citation |  Dorsey, BD; McDonough, C; McDaniel, SL; Levin, RB; Newton, CL; Hoffman, JM; Darke, PL; Zugay-Murphy, JA; Emini, EA; Schleif, WA; Olsen, DB; Stahlhut, MW; Rutkowski, CA; Kuo, LC; Lin, JH; Chen, IW; Michelson, SR; Holloway, MK; Huff, JR; Vacca, JP Identification of MK-944a: a second clinical candidate from the hydroxylaminepentanamide isostere series of HIV protease inhibitors. J Med Chem43:3386-99 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50091594 |
|---|
| n/a |
|---|
| Name | BDBM50091594 |
|---|
| Synonyms: | 2-{3-tert-Butylcarbamoyl-4-[2-hydroxy-4-(2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-piperazin-1-ylmethyl}-furo[2,3-b]pyridine-5-carboxylic acid ethyl ester | CHEMBL432633 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C41H51N5O7 |
|---|
| Mol. Mass. | 725.8729 |
|---|
| SMILES | CCOC(=O)c1cnc2oc(CN3CCN(CC(O)CC(Cc4ccccc4)C(=O)NC4C(O)Cc5ccccc45)C(C3)C(=O)NC(C)(C)C)cc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
