Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H3 receptor
LigandBDBM50099623
Substrate/Competitorn/a
Meas. Tech.ChEMBL_86747
Ki 0.18±n/a nM
Citation De Esch IJMills JEPerkins TDRomeo GHoffmann MWieland KLeurs RMenge WMNederkoorn PHDean PMTimmerman H Development of a pharmacophore model for histamine H3 receptor antagonists, using the newly developed molecular modeling program SLATE. J Med Chem 44:1666-74 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Histamine H3 receptor
Name:Histamine H3 receptor
Synonyms:HH3R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48607.98
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:445
Sequence:
MERAPPDGLMNASGTLAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVEAGEAALGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGRCIPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50099623
n/a
NameBDBM50099623
Synonyms:4-[2-(4,4-Dimethyl-pent-1-ynyl)-cyclopropyl]-1H-imidazole | CHEMBL45369
TypeSmall organic molecule
Emp. Form.C13H18N2
Mol. Mass.202.2954
SMILESCC(C)(C)CC#CC1CC1c1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: