Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM50218116 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_444839 (CHEMBL895094) |
---|
IC50 | 98±n/a nM |
---|
Citation | Dziadulewicz, EK; Bevan, SJ; Brain, CT; Coote, PR; Culshaw, AJ; Davis, AJ; Edwards, LJ; Fisher, AJ; Fox, AJ; Gentry, C; Groarke, A; Hart, TW; Huber, W; James, IF; Kesingland, A; La Vecchia, L; Loong, Y; Lyothier, I; McNair, K; O'Farrell, C; Peacock, M; Portmann, R; Schopfer, U; Yaqoob, M; Zadrobilek, J Naphthalen-1-yl-(4-pentyloxynaphthalen-1-yl)methanone: a potent, orally bioavailable human CB1/CB2 dual agonist with antihyperalgesic properties and restricted central nervous system penetration. J Med Chem50:3851-6 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM50218116 |
---|
n/a |
---|
Name | BDBM50218116 |
Synonyms: | CHEMBL244403 | naphthalen-1-yl-(4-pentyloxynaphthalen-1-yl)methanone |
Type | Small organic molecule |
Emp. Form. | C26H24O2 |
Mol. Mass. | 368.4676 |
SMILES | CCCCCOc1ccc(C(=O)c2cccc3ccccc23)c2ccccc12 |
Structure |
|