Reaction Details |
| Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50373368 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_467784 (CHEMBL931348) |
---|
IC50 | 320±n/a nM |
---|
Citation | Okamoto, O; Kobayashi, K; Kawamoto, H; Ito, S; Satoh, A; Kato, T; Yamamoto, I; Mizutani, S; Hashimoto, M; Shimizu, A; Sakoh, H; Nagatomi, Y; Iwasawa, Y; Takahashi, H; Ishii, Y; Ozaki, S; Ohta, H Identification of novel benzimidazole series of potent and selective ORL1 antagonists. Bioorg Med Chem Lett18:3278-81 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50373368 |
---|
n/a |
---|
Name | BDBM50373368 |
Synonyms: | CHEMBL263888 |
Type | Small organic molecule |
Emp. Form. | C16H24N4S |
Mol. Mass. | 304.454 |
SMILES | CCC(CC)Sc1nc2ccc(cc2[nH]1)N1CCNCC1 |
Structure |
|