Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysosomal Pro-X carboxypeptidase
LigandBDBM50382886
Substrate/Competitorn/a
Meas. Tech.ChEMBL_818260
IC50 10±n/a nM
Citation Graham THLiu WVerras AReibarkh MBleasby KBhatt URChen QGarcia-Calvo MGeissler WMGorski JNHe HLassman MELisnock JLi XShen ZTong XTung ECWiltsie JXie DXu SXiao JHale JJPinto SShen DM A new class of prolylcarboxypeptidase inhibitors, part 2: the aminocyclopentanes. Bioorg Med Chem Lett 22:2818-22 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysosomal Pro-X carboxypeptidase
Name:Lysosomal Pro-X carboxypeptidase
Synonyms:PRCP | Proline carboxypeptidase | Prolylcarboxypeptidase
Type:PROTEIN
Mol. Mass.:55028.96
Organism:Mus musculus
Description:ChEMBL_1335505
Residue:491
Sequence:
MGCRALLLLSFLLLGAATTIPPRLKTLGSPHLSASPTPDPAVARKYSVLYFEQKVDHFGF
ADMRTFKQRYLVADKHWQRNGGSILFYTGNEGDIVWFCNNTGFMWDVAEELKAMLVFAEH
RYYGESLPFGQDSFKDSQHLNFLTSEQALADFAELIRHLEKTIPGAQGQPVIAIGGSYGG
MLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMKIVTNDFRKSGPYCSESIRKSWN
VIDKLSGSGSGLQSLTNILHLCSPLTSEKIPTLKGWIAETWVNLAMVNYPYACNFLQPLP
AWPIKEVCQYLKNPNVSDTVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQ
ACTEMVMPFCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHSNI
IFSNGELDPWSGGGVTRDITDTLVAINIHDGAHHLDLRAHNAFDPSSVLLSRLLEVKHMK
KWILDFYSNIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50382886
n/a
NameBDBM50382886
Synonyms:CHEMBL2024198 | US8569299, 23
TypeSmall organic molecule
Emp. Form.C30H36ClF2N5O
Mol. Mass.556.09
SMILESCc1nc(C2CCN(CC2)C(=O)[C@@H]2CN(C[C@H]2c2ccc(F)cc2F)C(C)(C)C)n(n1)-c1ccc(Cl)c(C)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: