Reaction Details |
| Report a problem with these data |
Target | Free fatty acid receptor 1 |
---|
Ligand | BDBM50339489 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_826836 (CHEMBL2051553) |
---|
Ki | 27±n/a nM |
---|
Citation | Mikami, S; Kitamura, S; Negoro, N; Sasaki, S; Suzuki, M; Tsujihata, Y; Miyazaki, T; Ito, R; Suzuki, N; Miyazaki, J; Santou, T; Kanzaki, N; Funami, M; Tanaka, T; Yasuma, T; Momose, Y Discovery of phenylpropanoic acid derivatives containing polar functionalities as potent and orally bioavailable G protein-coupled receptor 40 agonists for the treatment of type 2 diabetes. J Med Chem55:3756-76 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Free fatty acid receptor 1 |
---|
Name: | Free fatty acid receptor 1 |
Synonyms: | FFAR1_RAT | Ffar1 | G-protein coupled receptor 40 | Gpr40 |
Type: | PROTEIN |
Mol. Mass.: | 31848.38 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_1511162 |
Residue: | 300 |
Sequence: | MDLPPQLSFALYVSAFALGFPLNLLAIRGAVSHAKLRLTPSLVYTLHLACSDLLLAITLP
LKAVEALASGVWPLPLPFCPVFALAHFAPLYAGGGFLAALSAGRYLGAAFPFGYQAIRRP
CYSWGVCVAIWALVLCHLGLALGLEAPRGWVDNTTSSLGINIPVNGSPVCLEAWDPDSAR
PARLSFSILLFFLPLVITAFCYVGCLRALVHSGLSHKRKLRAAWVAGGALLTLLLCLGPY
NASNVASFINPDLEGSWRKLGLITGAWSVVLNPLVTGYLGTGPGQGTICVTRTPRGTIQK
|
|
|
BDBM50339489 |
---|
n/a |
---|
Name | BDBM50339489 |
Synonyms: | 3-{4-[(2',6'-Dimethylbiphenyl-3-yl)methoxy]phenyl}propanoic Acid | CHEMBL1688486 |
Type | Small organic molecule |
Emp. Form. | C24H24O3 |
Mol. Mass. | 360.4456 |
SMILES | Cc1cccc(C)c1-c1cccc(COc2ccc(CCC(O)=O)cc2)c1 |
Structure |
|