| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Potassium channel subfamily K member 2 |
|---|
| Ligand | BDBM79180 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_938660 (CHEMBL2327432) |
|---|
| IC50 | 400±n/a nM |
|---|
| Citation |  Bagal, SK; Brown, AD; Cox, PJ; Omoto, K; Owen, RM; Pryde, DC; Sidders, B; Skerratt, SE; Stevens, EB; Storer, RI; Swain, NA Ion channels as therapeutic targets: a drug discovery perspective. J Med Chem56:593-624 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Potassium channel subfamily K member 2 |
|---|
| Name: | Potassium channel subfamily K member 2 |
|---|
| Synonyms: | KCNK2 | KCNK2_HUMAN | Outward rectifying potassium channel protein TREK-1 | TREK | TREK-1 K(+) channel subunit | TREK1 | Twik-RElated Potassium (K+) channel 1 (TREK1) | Two pore domain potassium channel TREK-1 | Two pore potassium channel TPKC1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 47099.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | O95069 |
|---|
| Residue: | 426 |
|---|
| Sequence: | MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
|
|
|
|---|
| BDBM79180 |
|---|
| n/a |
|---|
| Name | BDBM79180 |
|---|
| Synonyms: | 2-(2-aminoethoxymethyl)-4-(2-chlorophenyl)-6-methyl-1,4-dihydropyridine-3,5-dicarboxylic acid O3-ethyl ester O5-methyl ester;benzenesulfonic acid | 2-(2-aminoethoxymethyl)-4-(2-chlorophenyl)-6-methyl-1,4-dihydropyridine-3,5-dicarboxylic acid O3-ethyl ester O5-methyl ester;besylic acid | AMLODIPINE | MLS001331726 | SMR000814710 | benzenesulfonic acid;3-O-ethyl 5-O-methyl 2-(2-aminoethoxymethyl)-4-(2-chlorophenyl)-6-methyl-1,4-dihydropyridine-3,5-dicarboxylate | benzenesulfonic acid;O3-ethyl O5-methyl 2-(2-azanylethoxymethyl)-4-(2-chlorophenyl)-6-methyl-1,4-dihydropyridine-3,5-dicarboxylate | cid_60496 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25ClN2O5 |
|---|
| Mol. Mass. | 408.876 |
|---|
| SMILES | CCOC(=O)C1=C(COCCN)N=C(C)C(C1c1ccccc1Cl)C(=O)OC |c:5,t:12| |
|---|
| Structure | 
|
|---|
Search and Browse
