Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50427893
Substrate/Competitorn/a
Meas. Tech.ChEMBL_940885
EC50 10720±n/a nM
Citation Conda-Sheridan MPark EJBeck DEReddy PVNguyen TXHu BChen LWhite JJvan Breemen RBPezzuto JMCushman M Design, synthesis, and biological evaluation of indenoisoquinoline rexinoids with chemopreventive potential. J Med Chem 56:2581-605 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50427893
n/a
NameBDBM50427893
Synonyms:CHEMBL2322288
TypeSmall organic molecule
Emp. Form.C20H17BrN2O2
Mol. Mass.397.265
SMILESCNCCCn1c2-c3ccccc3C(=O)c2c2ccc(Br)cc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: