| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Ligand | BDBM50436358 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_966888 (CHEMBL2401179) |
|---|
| IC50 | 340±n/a nM |
|---|
| Citation |  He, Y; Liu, S; Menon, A; Stanford, S; Oppong, E; Gunawan, AM; Wu, L; Wu, DJ; Barrios, AM; Bottini, N; Cato, AC; Zhang, ZY A potent and selective small-molecule inhibitor for the lymphoid-specific tyrosine phosphatase (LYP), a target associated with autoimmune diseases. J Med Chem56:4990-5008 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Name: | Low molecular weight phosphotyrosine protein phosphatase |
|---|
| Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 18042.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P24666 |
|---|
| Residue: | 158 |
|---|
| Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
|---|
| BDBM50436358 |
|---|
| n/a |
|---|
| Name | BDBM50436358 |
|---|
| Synonyms: | CHEMBL2396718 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H22ClNO6 |
|---|
| Mol. Mass. | 503.93 |
|---|
| SMILES | CCCNC(=O)COc1ccc(cc1)-c1oc2cc(O)c(cc2c1C#Cc1cccc(Cl)c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
