| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dual specificity protein phosphatase 23 |
|---|
| Ligand | BDBM50436358 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_966891 (CHEMBL2401182) |
|---|
| IC50 | 3400±n/a nM |
|---|
| Citation |  He, Y; Liu, S; Menon, A; Stanford, S; Oppong, E; Gunawan, AM; Wu, L; Wu, DJ; Barrios, AM; Bottini, N; Cato, AC; Zhang, ZY A potent and selective small-molecule inhibitor for the lymphoid-specific tyrosine phosphatase (LYP), a target associated with autoimmune diseases. J Med Chem56:4990-5008 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dual specificity protein phosphatase 23 |
|---|
| Name: | Dual specificity protein phosphatase 23 |
|---|
| Synonyms: | DUS23_HUMAN | DUSP23 | Dual specificity protein phosphatase 23 | Dual specificity protein phosphatase 23 (VHZ) | LDP-3 | LDP3 | Low molecular mass dual specificity phosphatase 3 | VH1-like phosphatase Z | VHZ |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16592.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9BVJ7 |
|---|
| Residue: | 150 |
|---|
| Sequence: | MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHR
LRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGD
AIAEIRRLRPGSIETYEQEKAVFQFYQRTK
|
|
|
|---|
| BDBM50436358 |
|---|
| n/a |
|---|
| Name | BDBM50436358 |
|---|
| Synonyms: | CHEMBL2396718 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H22ClNO6 |
|---|
| Mol. Mass. | 503.93 |
|---|
| SMILES | CCCNC(=O)COc1ccc(cc1)-c1oc2cc(O)c(cc2c1C#Cc1cccc(Cl)c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
