| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Ligand | BDBM50436358 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_966907 (CHEMBL2401198) |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  He, Y; Liu, S; Menon, A; Stanford, S; Oppong, E; Gunawan, AM; Wu, L; Wu, DJ; Barrios, AM; Bottini, N; Cato, AC; Zhang, ZY A potent and selective small-molecule inhibitor for the lymphoid-specific tyrosine phosphatase (LYP), a target associated with autoimmune diseases. J Med Chem56:4990-5008 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 7 |
|---|
| Synonyms: | He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40530.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35236 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEP
ICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHA
SKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFW
EMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQY
QEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGC
FIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
|
|
|
|---|
| BDBM50436358 |
|---|
| n/a |
|---|
| Name | BDBM50436358 |
|---|
| Synonyms: | CHEMBL2396718 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H22ClNO6 |
|---|
| Mol. Mass. | 503.93 |
|---|
| SMILES | CCCNC(=O)COc1ccc(cc1)-c1oc2cc(O)c(cc2c1C#Cc1cccc(Cl)c1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
