| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin D |
|---|
| Ligand | BDBM50438357 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_973546 (CHEMBL2410948) |
|---|
| IC50 | 12±n/a nM |
|---|
| Citation |  Ng, RA; Sun, M; Bowers, S; Hom, RK; Probst, GD; John, V; Fang, LY; Maillard, M; Gailunas, A; Brogley, L; Neitz, RJ; Tung, JS; Pleiss, MA; Konradi, AW; Sham, HL; Dappen, MS; Adler, M; Yao, N; Zmolek, W; Nakamura, D; Quinn, KP; Sauer, JM; Bova, MP; Ruslim, L; Artis, DR; Yednock, TA Design and synthesis of hydroxyethylamine (HEA) BACE-1 inhibitors: prime side chromane-containing inhibitors. Bioorg Med Chem Lett23:4674-9 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin D |
|---|
| Name: | Cathepsin D |
|---|
| Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 44551.72 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
|---|
| Residue: | 412 |
|---|
| Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
|---|
| BDBM50438357 |
|---|
| n/a |
|---|
| Name | BDBM50438357 |
|---|
| Synonyms: | CHEMBL2408737 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H34F2N2O3 |
|---|
| Mol. Mass. | 460.5566 |
|---|
| SMILES | CC(=O)N[C@@H](Cc1cc(F)cc(F)c1)[C@H](O)CN[C@H]1CCOc2ccc(CC(C)(C)C)cc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
