| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 3A |
|---|
| Ligand | BDBM50440737 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_986342 (CHEMBL2433833) |
|---|
| Ki | 1000±n/a nM |
|---|
| Citation |  Peddibhotla, S; Hedrick, MP; Hershberger, P; Maloney, PR; Li, Y; Milewski, M; Gosalia, P; Gray, W; Mehta, A; Sugarman, E; Hood, B; Suyama, E; Nguyen, K; Heynen-Genel, S; Vasile, S; Salaniwal, S; Stonich, D; Su, Y; Mangravita-Novo, A; Vicchiarelli, M; Roth, GP; Smith, LH; Chung, TD; Hanson, GR; Thomas, JB; Caron, MG; Barak, LS; Pinkerton, AB Discovery of ML314, a Brain Penetrant Non-Peptidic?-Arrestin Biased Agonist of the Neurotensin NTR1 Receptor. ACS Med Chem Lett4:846-851 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 3A |
|---|
| Name: | 5-hydroxytryptamine receptor 3A |
|---|
| Synonyms: | 5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | 5HT3A_HUMAN | 5HT3R | HTR3 | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 55283.27 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46098 |
|---|
| Residue: | 478 |
|---|
| Sequence: | MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
|
|
|
|---|
| BDBM50440737 |
|---|
| n/a |
|---|
| Name | BDBM50440737 |
|---|
| Synonyms: | CHEMBL2431120 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H28N4O3 |
|---|
| Mol. Mass. | 420.5041 |
|---|
| SMILES | COc1ccccc1N1CCN(CC1)c1nc(nc2cc(OC)c(OC)cc12)C1CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
