Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPurinergic receptor P2Y12
LigandBDBM50055851
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1454018
IC50 50±n/a nM
Citation Boldron CBesse ABordes MFTissandié SYvon XGau BBadorc ARousseaux TBarré GMeneyrol JZech GNazare MFossey VPflieger AMBonnet-Lignon SMillet LBriot CDol FHérault JPSavi PLassalle GDelesque NHerbert JMBono F N-[6-(4-butanoyl-5-methyl-1H-pyrazol-1-yl)pyridazin-3-yl]-5-chloro-1-[2-(4-methylpiperazin-1-yl)-2-oxoethyl]-1H-indole-3-carboxamide (SAR216471), a novel intravenous and oral, reversible, and directly acting P2Y12 antagonist. J Med Chem 57:7293-316 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Purinergic receptor P2Y12
Name:Purinergic receptor P2Y12
Synonyms:ADP-glucose receptor | ADPG-R | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | SP1999
Type:Enzyme
Mol. Mass.:39458.48
Organism:Homo sapiens (Human)
Description:Q9H244
Residue:342
Sequence:
MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50055851
n/a
NameBDBM50055851
Synonyms:CHEMBL3325792
TypeSmall organic molecule
Emp. Form.C31H33F3N6O3
Mol. Mass.594.6273
SMILESCCCC(=O)c1cnn(c1C)-c1ccc(NC(=O)c2cn(CC(=O)N3CCN(C)CC3)c3ccc(cc23)C(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: