Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine 3-monooxygenase
LigandBDBM50072143
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1467939
IC50 21±n/a nM
Citation Toledo-Sherman LMPrime MEMrzljak LBeconi MGBeresford ABrookfield FABrown CJCardaun ICourtney SMDijkman UHamelin-Flegg EJohnson PDKempf VLyons KMatthews KMitchell WLO'Connell CPena PPowell KRassoulpour AReed LReindl WSelvaratnam SFriley WWWeddell DAWent NEWheelan PWinkler CWinkler DWityak JYarnold CJYates DMunoz-Sanjuan IDominguez C Development of a series of aryl pyrimidine kynurenine monooxygenase inhibitors as potential therapeutic agents for the treatment of Huntington's disease. J Med Chem 58:1159-83 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kynurenine 3-monooxygenase
Name:Kynurenine 3-monooxygenase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:55831.03
Organism:Homo sapiens (Human)
Description:ChEMBL_1487479
Residue:486
Sequence:
MDSSVIQRKKVAVIGGGLVGSLQACFLAKRNFQIDVYEAREDTRVATFTRGRSINLALSH
RGRQALKAVGLEDQIVSQGIPMRARMIHSLSGKKSAIPYGTKSQYILSVSRENLNKDLLT
AAEKYPNVKMHFNHRLLKCNPEEGMITVLGSDKVPKDVTCDLIVGCDGAYSTVRSHLMKK
PRFDYSQQYIPHGYMELTIPPKNGDYAMEPNYLHIWPRNTFMMIALPNMNKSFTCTLFMP
FEEFEKLLTSNDVVDFFQKYFPDAIPLIGEKLLVQDFFLLPAQPMISVKCSSFHFKSHCV
LLGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFSNDLSLCLPVFSRLRIPDDHAISDLS
MYNYIEMRAHVNSSWFIFQKNMERFLHAIMPSTFIPLYTMVTFSRIRYHEAVQRWHWQKK
VINKGLFFLGSLIAISSTYLLIHYMSPRSFLRLRRPWNWIAHFRNTTCFPAKAVDSLEQI
SNLISR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50072143
n/a
NameBDBM50072143
Synonyms:CHEMBL3407924
TypeSmall organic molecule
Emp. Form.C13H8N2O3
Mol. Mass.240.2142
SMILESOC(=O)c1cc(ncn1)-c1ccc2occc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: