Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50075208 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1473739 (CHEMBL3418256) |
---|
IC50 | 7100±n/a nM |
---|
Citation | Vernekar, SK; Liu, Z; Nagy, E; Miller, L; Kirby, KA; Wilson, DJ; Kankanala, J; Sarafianos, SG; Parniak, MA; Wang, Z Design, synthesis, biochemical, and antiviral evaluations of C6 benzyl and C6 biarylmethyl substituted 2-hydroxylisoquinoline-1,3-diones: dual inhibition against HIV reverse transcriptase-associated RNase H and polymerase with antiviral activities. J Med Chem58:651-64 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50075208 |
---|
n/a |
---|
Name | BDBM50075208 |
Synonyms: | CHEMBL3414860 |
Type | Small organic molecule |
Emp. Form. | C16H12ClNO3 |
Mol. Mass. | 301.724 |
SMILES | ON1C(=O)Cc2cc(Cc3ccc(Cl)cc3)ccc2C1=O |
Structure |
|