Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
LigandBDBM50086356
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476004
IC50 9.0±n/a nM
Citation Haffner CDBecherer JDBoros EECadilla RCarpenter TCowan DDeaton DNGuo YHarrington WHenke BRJeune MRKaldor IMilliken NPetrov KGPreugschat FSchulte CShearer BGShearer TSmalley TLStewart ELStuart JDUlrich JC Discovery, Synthesis, and Biological Evaluation of Thiazoloquin(az)olin(on)es as Potent CD38 Inhibitors. J Med Chem 58:3548-71 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
Name:ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
Synonyms:2''-phospho-ADP-ribosyl cyclase | 2''-phospho-ADP-ribosyl cyclase/2''-phospho-cyclic-ADP-ribose transferase | 2''-phospho-cyclic-ADP-ribose transferase | ADP-ribosyl cyclase 1 | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 | ADPRC 1 | CD_antigen=CD38 | Cd38 | Cyclic ADP-ribose hydrolase 1 | I-19 | NIM-R5 antigen | cADPr hydrolase 1
Type:PROTEIN
Mol. Mass.:34417.04
Organism:Mus musculus
Description:ChEMBL_109609
Residue:304
Sequence:
MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILLRPRSLLVWTGEPTTK
HFSDIFLGRCLIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCNITREDYAPLVKLVTQT
IPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYVSCPHW
SENCPNNPITVFWKVISQKFAEDACGVVQVMLNGSLREPFYKNSTFGSVEVFSLDPNKVH
KLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACVDNYRPARFLQCVKNPEHPSC
RLNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086356
n/a
NameBDBM50086356
Synonyms:CHEMBL3426052
TypeSmall organic molecule
Emp. Form.C18H12ClFN4OS
Mol. Mass.386.83
SMILESCOc1cc(cc2c(Nc3ccc(F)c(Cl)c3)ncnc12)-c1cncs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: